Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D8IUA2
dbSWEET id: dbswt_1715
Accession: D8IUA2
Uniprot status: Unreviewed
Organism: Herbaspirillum seropedicae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Oxalobacteraceae ⇒ Herbaspirillum.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: TATA CVV: 320 CHI: 2.2
Fasta sequence:
>tr|D8IUA2|D8IUA2_HERSS|Unreviewed|Herbaspirillum seropedicae| 106
MVHHGGTDFSTLPILTMSEHITDLIGWGATLILLLTISSQVYEQWRSRSTQGVSHWLFAG
PLAASAGFVTYSLLQGDWVFVVSNVFLLFTALLGQVLYLRNRRRQG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 23 Model end: 100 Inward Open: Template: 4X5M.pdb Model structure: D8IUA2_inward.pdb Alignment file: D8IUA2_inw.pir Procheck score ⇒ Ramachandran plot: 97.0% favored 3.0% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D8IUA2_outward.pdb Alignment file: D8IUA2_out.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.0% allowed .0% week .7% disallowed Occluded: Model structure: D8IUA2_occluded.pdb Alignment file: D8IUA2_occ.pir Procheck score ⇒ Ramachandran plot: 98.5% favored 1.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA