Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7SYD6

dbSWEET id: dbswt_486

Accession:   D7SYD6

Uniprot status:   Unreviewed

Organism:   Vitis vinifera

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.

Sequence Information back to top


Sequence length:   233

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|D7SYD6|D7SYD6_VITVI|Unreviewed|Vitis_vinifera|233
MESLSFFAGVIGNIISVLVFLAPIGTFWRIVKHRSTQDFESLPYVCTLLNSSLWTYYGII
KPGEILVATVNGFGVVVEAAYVTLFLIYAPAKMRAKTVALVSLLDVGFLAAAILVTRLAL
QGDTRIDALGFICSGLNIVMYGSPLAAMKTVVTTKSVEFMPFFLSFFLFLNGGIWTIYAV
LVRDYFLAVPNGTGLVLGTAQLVLYAIYRNSKPSNKFSIEDGSQEEHLIASSS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: D7SYD6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7SYD6_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.4% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7SYD6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    3.8% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7SYD6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.4% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   100255033     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur