| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D7MSV3
dbSWEET id: dbswt_572
Accession: D7MSV3
Uniprot status: Unreviewed
Organism: Arabidopsis lyrata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 260
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|D7MSV3|D7MSV3_ARALL|Unreviewed|Arabidopsis_lyrata|260
MGDKLRLSIGILGNGASLLLYTAPILTFSRVFKKKSTEEFSCFPYVMTLFNCLIYTWYGL
PIVSHLWENLPLVTINGVGILLESIFIFMYFCYASPKEKIKVGVTLVPVIVVFGLTTAIS
AVVFDDHRHRKSFVGSVGLVASISMYGSPLIVMKKVIETKSVEYMPFYLSFFSFLASSLW
LAYGLLSHDLFLASPNMVATPLGILQLVLYFKYKNKKELAPTTMVMSRRNDDEKNKAALE
LEVDVDRDSDANEKNSNNAC
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: D7MSV3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D7MSV3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.9% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D7MSV3_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D7MSV3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 87.2% favored 9.6% allowed 1.6% week 1.6% disallowed
Gene Informationback to top
Gene ID: 9302031 Total Exons: 8 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA