Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7MQB1

dbSWEET id: dbswt_206

Accession:   D7MQB1

Uniprot status:   Unreviewed

Organism:   Arabidopsis lyrata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   289

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|D7MQB1|D7MQB1_ARALL|Unreviewed|Arabidopsis_lyrata|289
MAISQAVLATVFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMY
YAMIKKDAMMLITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVLT
YFLIHANKRVHVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWF
FYGLLLKDMNIALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKLQDISEHVVDVVRL
STMVCNSQMRTLVPQDSADMEATIDIDEKIKGDIEKIKDDNEAFLISKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: D7MQB1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7MQB1_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.7% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7MQB1_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.6% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7MQB1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.7% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   9300153     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur