Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7MAB1

dbSWEET id: dbswt_513

Accession:   D7MAB1

Uniprot status:   Unreviewed

Organism:   Arabidopsis lyrata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   241

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VGMN           CVV:   373       CHI:   2.2

Fasta sequence:

>tr|D7MAB1|D7MAB1_ARALL|Unreviewed|Arabidopsis_lyrata|241
MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIA
TPGEYLVSTVNGFGAIVETIYVSLFLFYAPRHLKLNTVVVVAMLNVFFPIAAIVATRIAF
KDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA
LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEISQDEEEGLTSRVVPLL
S

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: D7MAB1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7MAB1_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.0% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7MAB1_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.5% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7MAB1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.5% allowed    2.7% week    .0% disallowed

Gene Informationback to top


Gene ID:   9306271     Total Exons:   10     Coding Exons:   8

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur