| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D7MAB1
dbSWEET id: dbswt_513
Accession: D7MAB1
Uniprot status: Unreviewed
Organism: Arabidopsis lyrata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.
Sequence Information back to top
Sequence length: 241
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VGMN CVV: 373 CHI: 2.2
Fasta sequence:
>tr|D7MAB1|D7MAB1_ARALL|Unreviewed|Arabidopsis_lyrata|241
MAEPSFYIGVIGNVISVLVFLSPVETFWKIVKRRSTEEYKSLPYICTLLGSSLWTYYGIA
TPGEYLVSTVNGFGAIVETIYVSLFLFYAPRHLKLNTVVVVAMLNVFFPIAAIVATRIAF
KDEKMRSQSIGFISAGLNIIMYGSPLSAMKTVVTTKSVKYMPFWLSFFLFLNGAIWAVYA
LLQHDVFLLVPNGVGFVFGTMQLILYGIYRNAKPVGLSNGLSEISQDEEEGLTSRVVPLL
S
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: D7MAB1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D7MAB1_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D7MAB1_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 6.5% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D7MAB1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 6.5% allowed 2.7% week .0% disallowed
Gene Informationback to top
Gene ID: 9306271 Total Exons: 10 Coding Exons: 8
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number








Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA