Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7LCE7

dbSWEET id: dbswt_245

Accession:   D7LCE7

Uniprot status:   Unreviewed

Organism:   Arabidopsis lyrata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   258

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|D7LCE7|D7LCE7_ARALL|Unreviewed|Arabidopsis_lyrata|258
MFLKVHELAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLY
YGIMKTHAYLIISINTFGCFIEISYLFLYIIYAPREAKISTLKLIVICNIGGLGLLILLV
NLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIKTKSVEYMPFLLSLSLTLNAVMWF
FYGLLIKDKFIAMPNILGFLFGVAQMILYMMYQGSTKTDLPTENQLANKTDVNEVPIVAV
ELPDVRSDNVEGSARPMK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: D7LCE7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7LCE7_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    3.7% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7LCE7_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7LCE7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   9315850     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur