Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7L661

dbSWEET id: dbswt_506

Accession:   D7L661

Uniprot status:   Unreviewed

Organism:   Arabidopsis lyrata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|D7L661|D7L661_ARALL|Unreviewed|Arabidopsis_lyrata|230
MVDLSFYVGVIGNVISVLVFLSPVETFWRIVQRRSTEEYECLPYICTLMSSSLWTYYGIV
TPGEYLVSTVNGFGALAESIYVLIFLFFVPKPRFLKTIVVVLALNVCFPVLAIVGTRTAF
EDENKRSSSMGFICATLNIAMYGSPLSAIKTVVTTRSVQFMPFWLSFFLFLNGAIWGVYA
FLLHDVFLLVPNGMGFLLGTMQLLIYAYYRNAQPNVEDEEGLIPSQPLLS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: D7L661.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7L661_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    3.2% allowed    1.1% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7L661_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.6% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7L661_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    8.6% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   9319086     Total Exons:   8     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur