Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7KK13

dbSWEET id: dbswt_710

Accession:   D7KK13

Uniprot status:   Unreviewed

Organism:   Arabidopsis lyrata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Camelineae ⇒ Arabidopsis.

Sequence Information back to top


Sequence length:   247

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|D7KK13|D7KK13_ARALL|Unreviewed|Arabidopsis_lyrata|247
MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLP
FVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKVKIFGIFSCVLAVFATVALVSLFA
LHGNGRKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYG
LIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAEKDEKSVEMKGDEKKQHVVN
GKQDLQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: D7KK13.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D7KK13_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.4% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D7KK13_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.2% favored    3.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D7KK13_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    4.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   9326507     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur