Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D7JDU4

dbSWEET id: dbswt_1712

Accession:   D7JDU4

Uniprot status:   Unreviewed

Organism:   Bacteroidetes oral

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|D7JDU4|D7JDU4_9BACT|Unreviewed|Bacteroidetes oral|86
MKKEKFFEYLGWVGMCTAILMYVFYFPQIKQNLAGNKGSFIQPFMAGVNCTLWVFYGLFK
EKRDLPVAIANAPGVIFGFLAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  D7JDU4_inward.pdb    Alignment file: D7JDU4_inw.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.9% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D7JDU4_outward.pdb    Alignment file: D7JDU4_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    8.7% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D7JDU4_occluded.pdb    Alignment file: D7JDU4_occ.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.8% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur