| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D6X0R8
dbSWEET id: dbswt_1150
Accession: D6X0R8
Uniprot status: Unreviewed
Organism: Tribolium castaneum
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Tenebrionidae ⇒ Tenebrionidae incertae sedis ⇒ Tribolium.
Sequence Information back to top
Sequence length: 225
Substrate Binding Site: GNWN CVV: 442 CHI: -2
Selectivity Filter: QLVV CVV: 448 CHI: 8.7
Fasta sequence:
>tr|D6X0R8|D6X0R8_TRICA|Unreviewed|Tribolium_castaneum|225
MESLSQTLQPHKDTVGTVASYLTILQFFSGVFICRDIYKKGNTDGVNSMPFVGGIMLGLA
MLKYGLMLGDENMLLVNLFAIVLNVIYCIVYYFYSNDKWKQILKPLSISMAFVAVLWGYC
EYESPSVVEFRYGLIVTILMLAVLGSPLLGVKEIIEKKDASEIPFVLTLMATLVTFSWLL
YAIILKNEFMLVQNVAGFVLCFVQLILIFAYPGGGRQVSKKKKKH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 213
Alignment file: D6X0R8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D6X0R8_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 6.5% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D6X0R8_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 8.1% allowed 2.2% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D6X0R8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 4.8% allowed 2.7% week .0% disallowed
Gene Informationback to top
Gene ID: 660743 Total Exons: 5 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5