Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D6X0R8

dbSWEET id: dbswt_1150

Accession:   D6X0R8

Uniprot status:   Unreviewed

Organism:   Tribolium castaneum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Tenebrionidae ⇒ Tenebrionidae incertae sedis ⇒ Tribolium.

Sequence Information back to top


Sequence length:   225

Substrate Binding Site:   GNWN           CVV:   442       CHI:   -2

Selectivity Filter:   QLVV           CVV:   448       CHI:   8.7

Fasta sequence:

>tr|D6X0R8|D6X0R8_TRICA|Unreviewed|Tribolium_castaneum|225
MESLSQTLQPHKDTVGTVASYLTILQFFSGVFICRDIYKKGNTDGVNSMPFVGGIMLGLA
MLKYGLMLGDENMLLVNLFAIVLNVIYCIVYYFYSNDKWKQILKPLSISMAFVAVLWGYC
EYESPSVVEFRYGLIVTILMLAVLGSPLLGVKEIIEKKDASEIPFVLTLMATLVTFSWLL
YAIILKNEFMLVQNVAGFVLCFVQLILIFAYPGGGRQVSKKKKKH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   213

Alignment file: D6X0R8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D6X0R8_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    6.5% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D6X0R8_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.1% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D6X0R8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    4.8% allowed    2.7% week    .0% disallowed

Gene Informationback to top


Gene ID:   660743     Total Exons:   5     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur