Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D6EB66

dbSWEET id: dbswt_1709

Accession:   D6EB66

Uniprot status:   Unreviewed

Organism:   Gordonibacter pamelaeae

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Eggerthellales ⇒ Eggerthellaceae ⇒ Gordonibacter.

Sequence Information back to top


Sequence length:   99

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|D6EB66|D6EB66_9ACTN|Unreviewed|Gordonibacter pamelaeae|99
MGQKGSVHRDGIKRHASPIAIVGRIASVLSVCMYVSYLPQIMDNLAGHPGNPVQPLAAFF
NCLFWTIYGLFEEERDWPIVVANVPGIFLAAATFLTAVF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   23     Model end:   99

Inward Open:

Template:   4X5M.pdb

Model structure:  D6EB66_inward.pdb    Alignment file: D6EB66_inw.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.6% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D6EB66_outward.pdb    Alignment file: D6EB66_out.pir

Procheck score ⇒ Ramachandran plot: 87.5% favored    8.6% allowed    2.3% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D6EB66_occluded.pdb    Alignment file: D6EB66_occ.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.9% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur