Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D5GZ40
dbSWEET id: dbswt_1708
Accession: D5GZ40
Uniprot status: Unreviewed
Organism: Lactobacillus crispatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D5GZ40|D5GZ40_LACCS|Unreviewed|Lactobacillus crispatus|88
MKKQDKYFLIIGRIASIMSVLMYVSYIAQIIANFQGQKGNPIQPFVAALNSTLWVLYGWM
NPVKRDWPIIIANIPGIFLGFITGITSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: D5GZ40_inward.pdb Alignment file: D5GZ40_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D5GZ40_outward.pdb Alignment file: D5GZ40_out.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 10.9% allowed 1.6% week .8% disallowed Occluded: Model structure: D5GZ40_occluded.pdb Alignment file: D5GZ40_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA