| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D5ABP0
dbSWEET id: dbswt_465
Accession: D5ABP0
Uniprot status: Unreviewed
Organism: Picea sitchensis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Pinidae ⇒ Pinales ⇒ Pinaceae ⇒ Picea.
Sequence Information back to top
Sequence length: 335
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: LSMN CVV: 417 CHI: 1.4
Fasta sequence:
>tr|D5ABP0|D5ABP0_PICSI|Unreviewed|Picea_sitchensis|335
MADVSFIIGVVGNVISLLLFISPVKTFWRIVKNKSTQDFKPLPYICTLLSTSLWTYYGLI
KPGGLLIVTVNGAGAALEAVYVILFIFYATKEHKLKTIVLVLLVDVVFFAAVFLVTFLVL
NQHIRLIVVGSLCVCVTLSMYVAPLAVMRSVMVTKSVEFMPFFLSFFLFLNGGVWAVWAV
LERDVFVGIPNGTGFGLGAAQLLVCMIYGKGKPRREGIREEDVKTEGFKLVGDIEMGGED
GADSKSHPNNLDEKRVSIPKANIHGLRKHVKSLSLDSGKLQSDADQLQFRLSLVPHHEGE
IQKTSENTECEKSYAESQPALIFCNWESHRPKHMH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: D5ABP0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D5ABP0_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.8% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D5ABP0_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D5ABP0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA