| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D4EIF7
dbSWEET id: dbswt_1706
Accession: D4EIF7
Uniprot status: Unreviewed
Organism: Enterococcus faecalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: WNWN CVV: 518 CHI: -8.8
Selectivity Filter: SFSF CVV: 416 CHI: 4
Fasta sequence:
>tr|D4EIF7|D4EIF7_ENTFL|Unreviewed|Enterococcus faecalis|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: D4EIF7_inward.pdb Alignment file: D4EIF7_inw.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 12.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D4EIF7_outward.pdb Alignment file: D4EIF7_out.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 11.5% allowed .0% week .8% disallowed Occluded: Model structure: D4EIF7_occluded.pdb Alignment file: D4EIF7_occ.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 11.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA