| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D4CVB8
dbSWEET id: dbswt_2025
Accession: D4CVB8
Uniprot status: Unreviewed
Organism: Fusobacterium periodonticum
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 365 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D4CVB8|D4CVB8_9FUSO|Unreviewed|Fusobacterium periodonticum|85
MTDKQIKVLGWLASTLAILMYVSYIPQIIGNLNGNKTSFIQPLVAAVNCIVWACYGFFKK
DRDLPLVFANIPGIIFGLIAAITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: D4CVB8_inward.pdb Alignment file: D4CVB8_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: D4CVB8_outward.pdb Alignment file: D4CVB8_out.pir Procheck score ⇒ Ramachandran plot: 87.5% favored 8.6% allowed 3.1% week .8% disallowed Occluded: Model structure: D4CVB8_occluded.pdb Alignment file: D4CVB8_occ.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 9.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA