Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D3ZH22
dbSWEET id: dbswt_977
Accession: D3ZH22
Uniprot status: Reviewed
Organism: Rattus norvegicus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Glires ⇒ Rodentia ⇒ Sciurognathi ⇒ Muroidea ⇒ Muridae ⇒ Murinae ⇒ Rattus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMS CVV: 417 CHI: -0.5
Fasta sequence:
>sp|D3ZH22|SWET1_RAT|Reviewed|Rattus_norvegicus|221
MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLGWLSY
GVLKGDGTLIIVNTVGAVLQTLYILAYLHYSPQKHAVLLQTATLLAVLLLGYGYFWLLVP
DLETRLQQLGLFCSVFTISMYLSPLADLAKIIQTKSTQRLSFSLTIATLLSSTSWSIYGF
RLKDPYITVPNLPGILTGFIRLVLFYKYPPEQDTKYRLLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: D3ZH22.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D3ZH22_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 5.9% allowed 2.7% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D3ZH22_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.9% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D3ZH22_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.5% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 295245 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0012505 - endomembrane system
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA