Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D3ZH22

dbSWEET id: dbswt_977

Accession:   D3ZH22

Uniprot status:   Reviewed

Organism:   Rattus norvegicus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Glires ⇒ Rodentia ⇒ Sciurognathi ⇒ Muroidea ⇒ Muridae ⇒ Murinae ⇒ Rattus.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMS           CVV:   417       CHI:   -0.5

Fasta sequence:

>sp|D3ZH22|SWET1_RAT|Reviewed|Rattus_norvegicus|221
MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLGWLSY
GVLKGDGTLIIVNTVGAVLQTLYILAYLHYSPQKHAVLLQTATLLAVLLLGYGYFWLLVP
DLETRLQQLGLFCSVFTISMYLSPLADLAKIIQTKSTQRLSFSLTIATLLSSTSWSIYGF
RLKDPYITVPNLPGILTGFIRLVLFYKYPPEQDTKYRLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: D3ZH22.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  D3ZH22_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    5.9% allowed    2.7% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  D3ZH22_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.9% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  D3ZH22_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.5% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   295245     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0012505 - endomembrane system

GO:0000139 - Golgi membrane

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur