| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D3PIC6
dbSWEET id: dbswt_1147
Accession: D3PIC6
Uniprot status: Unreviewed
Organism: Lepeophtheirus salmonis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Crustacea ⇒ Maxillopoda ⇒ Copepoda ⇒ Siphonostomatoida ⇒ Caligidae ⇒ Lepeophtheirus.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QMFV CVV: 478 CHI: 5.4
Fasta sequence:
>tr|D3PIC6|D3PIC6_LEPSM|Unreviewed|Lepeophtheirus_salmonis|229
MPVVSENMVNYLGNVATLFTIFQFISGVTVCLAIRKGKTTGDRSSITFISGALMCYVWYR
YGIAVKDSNILFVNLLGCVIHVAYSILFTYYCPSLKMKPIKIQCLVSFLIIIFLHGVKTI
VESEARITHYTGLLGSVLSIAFAASPLISLRHVFQTKSTEVLPFYIIIFVFVVSSLWGIY
GLCKGDPFLIFTNGTNAVISMFQLSLFAVYPSKNGYSLKKEGLSKESII
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 212
Alignment file: D3PIC6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: D3PIC6_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 7.4% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: D3PIC6_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: D3PIC6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 7.4% allowed 2.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA