Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D3IE56
dbSWEET id: dbswt_1702
Accession: D3IE56
Uniprot status: Unreviewed
Organism: Prevotella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: TFTF CVV: 456 CHI: 4.2
Selectivity Filter: FCFC CVV: 442 CHI: 10.6
Fasta sequence:
>tr|D3IE56|D3IE56_9BACT|Unreviewed|Prevotella|86
MTQEKFFGLLGWVGMVTAVLMYVFYFPQIQQNLAGNKGSFIQPFMAGVNCTLWVAYGLFK
KERDLPVAIANFPGVVFGFIAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: D3IE56_inward.pdb Alignment file: D3IE56_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D3IE56_outward.pdb Alignment file: D3IE56_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 4.8% allowed 2.4% week 1.6% disallowed Occluded: Model structure: D3IE56_occluded.pdb Alignment file: D3IE56_occ.pir Procheck score ⇒ Ramachandran plot: 96.0% favored 3.2% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA