Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D3IE56

dbSWEET id: dbswt_1702

Accession:   D3IE56

Uniprot status:   Unreviewed

Organism:   Prevotella

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   TFTF           CVV:   456       CHI:   4.2

Selectivity Filter:   FCFC           CVV:   442       CHI:   10.6

Fasta sequence:

>tr|D3IE56|D3IE56_9BACT|Unreviewed|Prevotella|86
MTQEKFFGLLGWVGMVTAVLMYVFYFPQIQQNLAGNKGSFIQPFMAGVNCTLWVAYGLFK
KERDLPVAIANFPGVVFGFIAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  D3IE56_inward.pdb    Alignment file: D3IE56_inw.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D3IE56_outward.pdb    Alignment file: D3IE56_out.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    4.8% allowed    2.4% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D3IE56_occluded.pdb    Alignment file: D3IE56_occ.pir

Procheck score ⇒ Ramachandran plot: 96.0% favored    3.2% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur