| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D3HYK0
dbSWEET id: dbswt_1701
Accession: D3HYK0
Uniprot status: Unreviewed
Organism: Prevotella buccae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|D3HYK0|D3HYK0_9BACT|Unreviewed|Prevotella buccae|86
MTKEKFFGAMGWVGMATSVLMYVFYFPQIQNNLEGHKGTFIQPFMAGINCTLWVAYGLFK
EKRDLPLAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: D3HYK0_inward.pdb Alignment file: D3HYK0_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: D3HYK0_outward.pdb Alignment file: D3HYK0_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Occluded: Model structure: D3HYK0_occluded.pdb Alignment file: D3HYK0_occ.pir Procheck score ⇒ Ramachandran plot: 96.8% favored 2.4% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA