Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D2NR54

dbSWEET id: dbswt_1696

Accession:   D2NR54

Uniprot status:   Unreviewed

Organism:   Rothia mucilaginosa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Micrococcales ⇒ Micrococcaceae ⇒ Rothia.

Sequence Information back to top


Sequence length:   109

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|D2NR54|D2NR54_ROTMD|Unreviewed|Rothia mucilaginosa| 109
MAEQNNTSAQNTSSKGGVGAESEFHAKFFPILARAASIAAVLMYVFYFPQIIGNLNGHKG
DWIQPLVAAINCTLWVLYGLWRPKKDIAIIIANAPGIVFGSLAAITALI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   33     Model end:   109

Inward Open:

Template:   4X5M.pdb

Model structure:  D2NR54_inward.pdb    Alignment file: D2NR54_inw.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.8% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D2NR54_outward.pdb    Alignment file: D2NR54_out.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    9.4% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D2NR54_occluded.pdb    Alignment file: D2NR54_occ.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    .8% allowed    .8% week    .8% disallowed

Gene Informationback to top


Gene ID:   25056915

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur