Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D2MP34

dbSWEET id: dbswt_1695

Accession:   D2MP34

Uniprot status:   Unreviewed

Organism:   Bulleidia extructa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Erysipelotrichia ⇒ Erysipelotrichales ⇒ Erysipelotrichaceae ⇒ Bulleidia.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|D2MP34|D2MP34_9FIRM|Unreviewed|Bulleidia extructa|85
MKPKTLKMMGWIATGTAMLMYISYLPQIIHNIHGVKSGFLQPMVAAINCVLWVSYGFFQE
KKDWPIVIANLPGVILGTIAAMTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  D2MP34_inward.pdb    Alignment file: D2MP34_inw.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    3.9% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D2MP34_outward.pdb    Alignment file: D2MP34_out.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.4% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D2MP34_occluded.pdb    Alignment file: D2MP34_occ.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.8% allowed    2.3% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur