| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D2MP34
dbSWEET id: dbswt_1695
Accession: D2MP34
Uniprot status: Unreviewed
Organism: Bulleidia extructa
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Erysipelotrichia ⇒ Erysipelotrichales ⇒ Erysipelotrichaceae ⇒ Bulleidia.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D2MP34|D2MP34_9FIRM|Unreviewed|Bulleidia extructa|85
MKPKTLKMMGWIATGTAMLMYISYLPQIIHNIHGVKSGFLQPMVAAINCVLWVSYGFFQE
KKDWPIVIANLPGVILGTIAAMTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: D2MP34_inward.pdb Alignment file: D2MP34_inw.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 3.9% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: D2MP34_outward.pdb Alignment file: D2MP34_out.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 9.4% allowed .8% week .0% disallowed Occluded: Model structure: D2MP34_occluded.pdb Alignment file: D2MP34_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.8% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA