Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D2EL68
dbSWEET id: dbswt_1694
Accession: D2EL68
Uniprot status: Unreviewed
Organism: Pediococcus acidilactici
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Pediococcus ⇒ Pediococcus acidilactici group.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D2EL68|D2EL68_PEDAC|Unreviewed|Pediococcus acidilactici|88
MQEETKVIRIIGRMASVLSVLMYVSYIPQIISNMHGDYGNPIQPLVAGINCTVWTIYGYF
KSERDWPIIVANVPGIFLGFFTFYTALH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: D2EL68_inward.pdb Alignment file: D2EL68_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D2EL68_outward.pdb Alignment file: D2EL68_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 4.8% allowed 1.6% week .8% disallowed Occluded: Model structure: D2EL68_occluded.pdb Alignment file: D2EL68_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA