Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D1Z127

dbSWEET id: dbswt_2076

Accession:   D1Z127

Uniprot status:   Unreviewed

Organism:   Methanocella paludicola

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanocellales;Methanocellaceae ⇒ Methanocella.

Sequence Information back to top


Sequence length:   84

Substrate Binding Site:   MNMN           CVV:   440       CHI:   -3.2

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|D1Z127|D1Z127_METPS|Unreviewed|Methanocella paludicola|84
MDSIVLVGLVAGALTTSSCIPQAARIIRTKSAKDVSALFFGLMAAGMSLWLVYGLARSDV
AIVLWNAISLAFCILILILKRVYG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  D1Z127_inward.pdb    Alignment file: D1Z127_inw.pir

Procheck score ⇒ Ramachandran plot: 92.8% favored    5.8% allowed    .7% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D1Z127_outward.pdb    Alignment file: D1Z127_out.pir

Procheck score ⇒ Ramachandran plot: 92.8% favored    7.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D1Z127_occluded.pdb    Alignment file: D1Z127_occ.pir

Procheck score ⇒ Ramachandran plot: 96.4% favored    3.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur