Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D1Z127
dbSWEET id: dbswt_2076
Accession: D1Z127
Uniprot status: Unreviewed
Organism: Methanocella paludicola
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanocellales;Methanocellaceae ⇒ Methanocella.
Sequence Information back to top
Sequence length: 84
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|D1Z127|D1Z127_METPS|Unreviewed|Methanocella paludicola|84
MDSIVLVGLVAGALTTSSCIPQAARIIRTKSAKDVSALFFGLMAAGMSLWLVYGLARSDV
AIVLWNAISLAFCILILILKRVYG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: D1Z127_inward.pdb Alignment file: D1Z127_inw.pir Procheck score ⇒ Ramachandran plot: 92.8% favored 5.8% allowed .7% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: D1Z127_outward.pdb Alignment file: D1Z127_out.pir Procheck score ⇒ Ramachandran plot: 92.8% favored 7.2% allowed .0% week .0% disallowed Occluded: Model structure: D1Z127_occluded.pdb Alignment file: D1Z127_occ.pir Procheck score ⇒ Ramachandran plot: 96.4% favored 3.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA