Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D1YFT9

dbSWEET id: dbswt_1693

Accession:   D1YFT9

Uniprot status:   Unreviewed

Organism:   Lactobacillus gasseri

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   93

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|D1YFT9|D1YFT9_LACGS|Unreviewed|Lactobacillus gasseri|93
MKKKIKSFDNKTVLTIGRIGSVLSVLMYVSYIPQIMNNLQGNYGNPIQPLVAAINCLIWV
LYALLREKKDWPLFVANFPGILFGLTTFITSLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   17     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  D1YFT9_inward.pdb    Alignment file: D1YFT9_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D1YFT9_outward.pdb    Alignment file: D1YFT9_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.0% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D1YFT9_occluded.pdb    Alignment file: D1YFT9_occ.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.5% allowed    .8% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur