| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D1YFT9
dbSWEET id: dbswt_1693
Accession: D1YFT9
Uniprot status: Unreviewed
Organism: Lactobacillus gasseri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D1YFT9|D1YFT9_LACGS|Unreviewed|Lactobacillus gasseri|93
MKKKIKSFDNKTVLTIGRIGSVLSVLMYVSYIPQIMNNLQGNYGNPIQPLVAAINCLIWV
LYALLREKKDWPLFVANFPGILFGLTTFITSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: D1YFT9_inward.pdb Alignment file: D1YFT9_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: D1YFT9_outward.pdb Alignment file: D1YFT9_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .8% week .0% disallowed Occluded: Model structure: D1YFT9_occluded.pdb Alignment file: D1YFT9_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 5.5% allowed .8% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA