Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : D0WE47
dbSWEET id: dbswt_1691
Accession: D0WE47
Uniprot status: Unreviewed
Organism: Slackia exigua
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Eggerthellales ⇒ Eggerthellaceae ⇒ Slackia.
Sequence Information back to top
Sequence length: 124
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|D0WE47|D0WE47_SLAES|Unreviewed|Slackia exigua| 124
MRVQLRIRIDGCAQEAEAPPQAMMHDRAESPDRGGGDETMNQKTLGIVGWIATCTAMLMY
IAYFPQIIHNLHGDKSGFPQPLVAAINCTLWVSYGFFQEKKDWPIVVANVPGVIFGALAA
LTAP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 49 Model end: 125 Inward Open: Template: 4X5M.pdb Model structure: D0WE47_inward.pdb Alignment file: D0WE47_inw.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 6.2% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: D0WE47_outward.pdb Alignment file: D0WE47_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed Occluded: Model structure: D0WE47_occluded.pdb Alignment file: D0WE47_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 10.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA