Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D0W637

dbSWEET id: dbswt_1690

Accession:   D0W637

Uniprot status:   Unreviewed

Organism:   Neisseria cinerea

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Neisseria.

Sequence Information back to top


Sequence length:   123

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|D0W637|D0W637_NEICI|Unreviewed|Neisseria cinerea| 123
MPEPAKAALTTSSIAILLRYIKGRTIKIFEKGYLSMISKKKFNAFIGSIGAAIGIFVFIA
YIPQIIANLEGEKAQPWQPLFAAVSCLIWVLYGWSKEPKKDWILIVPNAVGVILGSLTFL
TAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   47     Model end:   124

Inward Open:

Template:   4X5M.pdb

Model structure:  D0W637_inward.pdb    Alignment file: D0W637_inw.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.6% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D0W637_outward.pdb    Alignment file: D0W637_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D0W637_occluded.pdb    Alignment file: D0W637_occ.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    10.2% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur