Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D0GPV1

dbSWEET id: dbswt_1689

Accession:   D0GPV1

Uniprot status:   Unreviewed

Organism:   Leptotrichia goodfellowii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Leptotrichiaceae ⇒ Leptotrichia.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|D0GPV1|D0GPV1_9FUSO|Unreviewed|Leptotrichia goodfellowii|85
MSEKNLKILGWIGTFLSVIMYVSYIPQIMGNLHGNKTPFLQPLAAAINCTIWTSYGLLKE
KKDYPLSAANLPGIIFGLLATITAF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  D0GPV1_inward.pdb    Alignment file: D0GPV1_inw.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D0GPV1_outward.pdb    Alignment file: D0GPV1_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D0GPV1_occluded.pdb    Alignment file: D0GPV1_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    4.8% allowed    3.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur