Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D0DTB6

dbSWEET id: dbswt_1687

Accession:   D0DTB6

Uniprot status:   Unreviewed

Organism:   Lactobacillus fermentum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   95

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|D0DTB6|D0DTB6_LACFE|Unreviewed|Lactobacillus fermentum|95
MMSKEELNRRLHQAKIVGNTATIACLIMYTSYIQQIISNFTGHPVSPLQPICASINALLW
VAYGWIKPKKDWPVIIANFPGIIFGILTFVTAYLY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   18     Model end:   94

Inward Open:

Template:   4X5M.pdb

Model structure:  D0DTB6_inward.pdb    Alignment file: D0DTB6_inw.pir

Procheck score ⇒ Ramachandran plot: 86.7% favored    10.9% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D0DTB6_outward.pdb    Alignment file: D0DTB6_out.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D0DTB6_occluded.pdb    Alignment file: D0DTB6_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.5% allowed    2.3% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur