| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : D0DFM6
dbSWEET id: dbswt_1686
Accession: D0DFM6
Uniprot status: Unreviewed
Organism: Lactobacillus crispatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 93
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|D0DFM6|D0DFM6_9LACO|Unreviewed|Lactobacillus crispatus|93
MLKKFKGLDRKTVLTIGRIGSVLSVLMYVSYIPQIINNLNGNYGNPVQPLVAAINCTIWV
LYAILGEKKDWPLFTANFPGIIFGLITFFTSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: D0DFM6_inward.pdb Alignment file: D0DFM6_inw.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 9.5% allowed 3.2% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: D0DFM6_outward.pdb Alignment file: D0DFM6_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .0% week .8% disallowed Occluded: Model structure: D0DFM6_occluded.pdb Alignment file: D0DFM6_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA