Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : D0BLI8

dbSWEET id: dbswt_1685

Accession:   D0BLI8

Uniprot status:   Unreviewed

Organism:   Granulicatella elegans

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Carnobacteriaceae ⇒ Granulicatella.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|D0BLI8|D0BLI8_9LACT|Unreviewed|Granulicatella elegans|88
MSKQKINRFVGSIGAFIGILVFIAYIPQIIANLQGEKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFITSLK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  D0BLI8_inward.pdb    Alignment file: D0BLI8_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.5% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  D0BLI8_outward.pdb    Alignment file: D0BLI8_out.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    10.3% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  D0BLI8_occluded.pdb    Alignment file: D0BLI8_occ.pir

Procheck score ⇒ Ramachandran plot: 85.7% favored    10.3% allowed    3.2% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur