Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C9MYG0
dbSWEET id: dbswt_1684
Accession: C9MYG0
Uniprot status: Unreviewed
Organism: Leptotrichia hofstadii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C9MYG0|C9MYG0_9FUSO|Unreviewed|Leptotrichia hofstadii|85
MSEKNLKILGWIGTLLSVIMYVSYVPQIMGNLHGHKTFFLQPLSAAINCTIWTSYGLLKE
KKDYPLSAANFPGVVFGLLATITAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: C9MYG0_inward.pdb Alignment file: C9MYG0_inw.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 5.5% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C9MYG0_outward.pdb Alignment file: C9MYG0_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.7% allowed 1.6% week .0% disallowed Occluded: Model structure: C9MYG0_occluded.pdb Alignment file: C9MYG0_occ.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 5.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA