Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C9MYD8

dbSWEET id: dbswt_1683

Accession:   C9MYD8

Uniprot status:   Unreviewed

Organism:   Leptotrichia hofstadii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Leptotrichiaceae ⇒ Leptotrichia.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TSTS           CVV:   332       CHI:   -3

Fasta sequence:

>tr|C9MYD8|C9MYD8_9FUSO|Unreviewed|Leptotrichia hofstadii|87
MDKKKINTIVGSIGAFIGIFVFITYIPQIIANIGGEKAQPWQPLTASVSCLIWVIYGWTK
EPKKDYILIVPNAAGVILGFLTFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  C9MYD8_inward.pdb    Alignment file: C9MYD8_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    8.7% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C9MYD8_outward.pdb    Alignment file: C9MYD8_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C9MYD8_occluded.pdb    Alignment file: C9MYD8_occ.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.1% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur