| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C9LR35
dbSWEET id: dbswt_1681
Accession: C9LR35
Uniprot status: Unreviewed
Organism: Dialister invisus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Dialister.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C9LR35|C9LR35_9FIRM|Unreviewed|Dialister invisus|88
MNEKIVKALGSVAAVAAIVMYVSYIPQIIGNLHGNRGDYIQPLAAAINCILWVGYGLLKK
ERDWPIAIANFPGVIFGLMAFLTALIPF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: C9LR35_inward.pdb Alignment file: C9LR35_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: C9LR35_outward.pdb Alignment file: C9LR35_out.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 2.4% week .0% disallowed Occluded: Model structure: C9LR35_occluded.pdb Alignment file: C9LR35_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA