Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C9LR35

dbSWEET id: dbswt_1681

Accession:   C9LR35

Uniprot status:   Unreviewed

Organism:   Dialister invisus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Dialister.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C9LR35|C9LR35_9FIRM|Unreviewed|Dialister invisus|88
MNEKIVKALGSVAAVAAIVMYVSYIPQIIGNLHGNRGDYIQPLAAAINCILWVGYGLLKK
ERDWPIAIANFPGVIFGLMAFLTALIPF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  C9LR35_inward.pdb    Alignment file: C9LR35_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.9% allowed    .8% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C9LR35_outward.pdb    Alignment file: C9LR35_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.1% allowed    2.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C9LR35_occluded.pdb    Alignment file: C9LR35_occ.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur