| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C9LPU9
dbSWEET id: dbswt_1680
Accession: C9LPU9
Uniprot status: Unreviewed
Organism: Dialister invisus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Dialister.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: TSTS CVV: 332 CHI: -3
Fasta sequence:
>tr|C9LPU9|C9LPU9_9FIRM|Unreviewed|Dialister invisus|87
MNKKKINTIVGSIGAFIGVFVFITYIPQIIANLGGEKAQPWQPLTASISCLIWVIYGWTK
EPKKDFILIVPNLAGVILGFLTFITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: C9LPU9_inward.pdb Alignment file: C9LPU9_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: C9LPU9_outward.pdb Alignment file: C9LPU9_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.8% allowed .8% week .0% disallowed Occluded: Model structure: C9LPU9_occluded.pdb Alignment file: C9LPU9_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 8.7% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA