Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C9LJV7

dbSWEET id: dbswt_1679

Accession:   C9LJV7

Uniprot status:   Unreviewed

Organism:   Alloprevotella tannerae

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Alloprevotella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C9LJV7|C9LJV7_9BACT|Unreviewed|Alloprevotella tannerae|86
MTQEKFLSILGWVATATAMAMYISYIPQIGSNLSGHKGDWLQPMVAGINCVLWVGYGFFR
KKKDWPIVIANFPGVVCGFMASFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  C9LJV7_inward.pdb    Alignment file: C9LJV7_inw.pir

Procheck score ⇒ Ramachandran plot: 84.7% favored    12.9% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C9LJV7_outward.pdb    Alignment file: C9LJV7_out.pir

Procheck score ⇒ Ramachandran plot: 88.7% favored    7.3% allowed    2.4% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C9LJV7_occluded.pdb    Alignment file: C9LJV7_occ.pir

Procheck score ⇒ Ramachandran plot: 85.5% favored    11.3% allowed    3.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur