| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C8YZA9
dbSWEET id: dbswt_233
Accession: C8YZA9
Uniprot status: Unreviewed
Organism: Capsicum annuum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Capsiceae ⇒ Capsicum.
Sequence Information back to top
Sequence length: 301
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|C8YZA9|C8YZA9_CAPAN|Unreviewed|Capsicum_annuum|301
MTGISGHWAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIY
YAFLKTNVTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVT
QFLFKGVVRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWF
FYGLLLKDINIAAPNVLGFIFGVLQIVLYAIYSKKEKVILKEQKLPEIQKPAVIVADDNT
NANKKLPELTHEQIIDIVKLAGLLTCTEKSHVATCPHDVNCGVEATNVENNIPKLQTVEA
T
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: C8YZA9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C8YZA9_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.3% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C8YZA9_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.8% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C8YZA9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.3% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA