Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C8PKN4

dbSWEET id: dbswt_1676

Accession:   C8PKN4

Uniprot status:   Unreviewed

Organism:   Campylobacter gracilis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   TNTN           CVV:   378       CHI:   -8.4

Selectivity Filter:   SCSC           CVV:   318       CHI:   3.4

Fasta sequence:

>tr|C8PKN4|C8PKN4_9PROT|Unreviewed|Campylobacter gracilis|85
MSERNLQILGWAGTCLSVIMYVSYVPNIMANLDGNKVPFLQPLAAAINCTIWVSYGLLKP
KKDYPLAAANFPGIIFGLLTAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  C8PKN4_inward.pdb    Alignment file: C8PKN4_inw.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    7.9% allowed    4.0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C8PKN4_outward.pdb    Alignment file: C8PKN4_out.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.1% allowed    3.2% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C8PKN4_occluded.pdb    Alignment file: C8PKN4_occ.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    7.9% allowed    .8% week    2.4% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur