Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C8P5E2
dbSWEET id: dbswt_1675
Accession: C8P5E2
Uniprot status: Unreviewed
Organism: Lactobacillus antri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C8P5E2|C8P5E2_9LACO|Unreviewed|Lactobacillus antri|95
MDNQKLTTKQKVRKYTGNFATVACLVMYFSYIEQIIANFTGQPVSPVQPFFASINALLWV
IYGWVKPDKKDWPVIIANFPGIIFGLVTAVTSFIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: C8P5E2_inward.pdb Alignment file: C8P5E2_inw.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 5.4% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C8P5E2_outward.pdb Alignment file: C8P5E2_out.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .8% week .0% disallowed Occluded: Model structure: C8P5E2_occluded.pdb Alignment file: C8P5E2_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.2% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA