| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C8P3Z3
dbSWEET id: dbswt_1674
Accession: C8P3Z3
Uniprot status: Unreviewed
Organism: Lactobacillus antri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C8P3Z3|C8P3Z3_9LACO|Unreviewed|Lactobacillus antri|87
MKETKFIRVLSVIASVIAVCMYVSYIPQIINNLHGAYCAPLQPFVAGLNCTLWSIYAWFK
SERDWAVFVANFPGIFFGFITFFTALH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: C8P3Z3_inward.pdb Alignment file: C8P3Z3_inw.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 10.6% allowed .8% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: C8P3Z3_outward.pdb Alignment file: C8P3Z3_out.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 9.1% allowed 2.3% week .8% disallowed Occluded: Model structure: C8P3Z3_occluded.pdb Alignment file: C8P3Z3_occ.pir Procheck score ⇒ Ramachandran plot: 85.6% favored 11.4% allowed 1.5% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA