Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C8P3Z3

dbSWEET id: dbswt_1674

Accession:   C8P3Z3

Uniprot status:   Unreviewed

Organism:   Lactobacillus antri

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C8P3Z3|C8P3Z3_9LACO|Unreviewed|Lactobacillus antri|87
MKETKFIRVLSVIASVIAVCMYVSYIPQIINNLHGAYCAPLQPFVAGLNCTLWSIYAWFK
SERDWAVFVANFPGIFFGFITFFTALH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  C8P3Z3_inward.pdb    Alignment file: C8P3Z3_inw.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    10.6% allowed    .8% week    1.5% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C8P3Z3_outward.pdb    Alignment file: C8P3Z3_out.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    9.1% allowed    2.3% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C8P3Z3_occluded.pdb    Alignment file: C8P3Z3_occ.pir

Procheck score ⇒ Ramachandran plot: 85.6% favored    11.4% allowed    1.5% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur