Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C8NIK0

dbSWEET id: dbswt_1673

Accession:   C8NIK0

Uniprot status:   Unreviewed

Organism:   Granulicatella adiacens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Carnobacteriaceae ⇒ Granulicatella.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|C8NIK0|C8NIK0_9LACT|Unreviewed|Granulicatella adiacens|94
MKGADCMKLSEKQTQVLGWIATCMSVAMYVAYIPQIMNNLAGNKGDFIQPLVAALNCSLW
VYYGLFKPNRDIPLAAANAPGIFFGLASALTALF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   18     Model end:   94

Inward Open:

Template:   4X5M.pdb

Model structure:  C8NIK0_inward.pdb    Alignment file: C8NIK0_inw.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    7.0% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C8NIK0_outward.pdb    Alignment file: C8NIK0_out.pir

Procheck score ⇒ Ramachandran plot: 96.1% favored    3.9% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C8NIK0_occluded.pdb    Alignment file: C8NIK0_occ.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.2% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur