Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C8NFE5

dbSWEET id: dbswt_1672

Accession:   C8NFE5

Uniprot status:   Unreviewed

Organism:   Granulicatella adiacens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Carnobacteriaceae ⇒ Granulicatella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CPCP           CVV:   352       CHI:   1.8

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|C8NFE5|C8NFE5_9LACT|Unreviewed|Granulicatella adiacens|87
MSKQKINRFVGSIGAFVGVLVFIAYIPQIIANLQGAKAQPFQPLFAAASCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFITSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  C8NFE5_inward.pdb    Alignment file: C8NFE5_inw.pir

Procheck score ⇒ Ramachandran plot: 83.9% favored    12.1% allowed    2.4% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C8NFE5_outward.pdb    Alignment file: C8NFE5_out.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    8.1% allowed    4.0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C8NFE5_occluded.pdb    Alignment file: C8NFE5_occ.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur