Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C7XXL6

dbSWEET id: dbswt_1670

Accession:   C7XXL6

Uniprot status:   Unreviewed

Organism:   Lactobacillus coleohominis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   GNGN           CVV:   288       CHI:   -7.8

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C7XXL6|C7XXL6_9LACO|Unreviewed|Lactobacillus coleohominis| 105
MDAQKNKLEDVRKEMLSGEKHSAIMIGRIASIFTIMMYVSYIPQIVANLHGHPVNILQPT
VAAFNGFLWCAYALNKRHRDWAVFIGNFPGIIFGIITVMTALLAH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   27     Model end:   103

Inward Open:

Template:   4X5M.pdb

Model structure:  C7XXL6_inward.pdb    Alignment file: C7XXL6_inw.pir

Procheck score ⇒ Ramachandran plot: 86.2% favored    10.0% allowed    1.5% week    2.3% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C7XXL6_outward.pdb    Alignment file: C7XXL6_out.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.9% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C7XXL6_occluded.pdb    Alignment file: C7XXL6_occ.pir

Procheck score ⇒ Ramachandran plot: 86.2% favored    12.3% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur