| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C7XXL6
dbSWEET id: dbswt_1670
Accession: C7XXL6
Uniprot status: Unreviewed
Organism: Lactobacillus coleohominis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 105
Substrate Binding Site: GNGN CVV: 288 CHI: -7.8
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C7XXL6|C7XXL6_9LACO|Unreviewed|Lactobacillus coleohominis| 105
MDAQKNKLEDVRKEMLSGEKHSAIMIGRIASIFTIMMYVSYIPQIVANLHGHPVNILQPT
VAAFNGFLWCAYALNKRHRDWAVFIGNFPGIIFGIITVMTALLAH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: C7XXL6_inward.pdb Alignment file: C7XXL6_inw.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 10.0% allowed 1.5% week 2.3% disallowed Outward Open: Template: 4X5N.pdb Model structure: C7XXL6_outward.pdb Alignment file: C7XXL6_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.9% allowed 2.3% week .0% disallowed Occluded: Model structure: C7XXL6_occluded.pdb Alignment file: C7XXL6_occ.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 12.3% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA