Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C7NEM5

dbSWEET id: dbswt_1668

Accession:   C7NEM5

Uniprot status:   Unreviewed

Organism:   Leptotrichia buccalis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Leptotrichiaceae ⇒ Leptotrichia.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TSTS           CVV:   332       CHI:   -3

Fasta sequence:

>tr|C7NEM5|C7NEM5_LEPBD|Unreviewed|Leptotrichia buccalis|87
MNKKKINTLVGSIGAFIGIIVFITYIPQIIANIGGQKAQPWQPLSASISCLIWVIYGWTK
EPKKDYILIVPNAAGVILGFLTFITAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  C7NEM5_inward.pdb    Alignment file: C7NEM5_inw.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C7NEM5_outward.pdb    Alignment file: C7NEM5_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.3% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C7NEM5_occluded.pdb    Alignment file: C7NEM5_occ.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    5.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur