Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C7MP76

dbSWEET id: dbswt_1666

Accession:   C7MP76

Uniprot status:   Unreviewed

Organism:   Cryptobacterium curtum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Eggerthellales ⇒ Eggerthellaceae ⇒ Cryptobacterium.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|C7MP76|C7MP76_CRYCD|Unreviewed|Cryptobacterium curtum|85
MNQKAFKIIGWIATCTAMLMYIAYFPQILNNLNGDKSGFLQPMVAAINCTLWVCYGFFQK
KKDWPIVVANIPGVLFGAVAAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  C7MP76_inward.pdb    Alignment file: C7MP76_inw.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    11.5% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C7MP76_outward.pdb    Alignment file: C7MP76_out.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    8.5% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C7MP76_occluded.pdb    Alignment file: C7MP76_occ.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    13.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur