Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C7M8T9

dbSWEET id: dbswt_1665

Accession:   C7M8T9

Uniprot status:   Unreviewed

Organism:   Capnocytophaga ochracea

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|C7M8T9|C7M8T9_CAPOD|Unreviewed|Capnocytophaga ochracea|92
MKEKRNTKQKINLFIGSIGAFIGVAVFVAYIPQIMANLEGHKAQPWQPLFAAGSCLIWVV
YGWTKEPKPDYILIIPNFVGVVLGFLTFITSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  C7M8T9_inward.pdb    Alignment file: C7M8T9_inw.pir

Procheck score ⇒ Ramachandran plot: 84.7% favored    13.7% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C7M8T9_outward.pdb    Alignment file: C7M8T9_out.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.3% allowed    2.4% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C7M8T9_occluded.pdb    Alignment file: C7M8T9_occ.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    12.1% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur