Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C6VSL3

dbSWEET id: dbswt_1662

Accession:   C6VSL3

Uniprot status:   Unreviewed

Organism:   Dyadobacter fermentans

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Cytophagia ⇒ Cytophagales ⇒ Cytophagaceae ⇒ Dyadobacter.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   NNNN           CVV:   384       CHI:   -14

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|C6VSL3|C6VSL3_DYAFD|Unreviewed|Dyadobacter fermentans|89
MDFIEIIGLVAGICTSSAVIPQLVTTIKKKKASQVSTAMFIVLLTGNALWVYYGFEKEDV
PIVATNLFTIGLNIAMLVLKYKYKKRQTE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  C6VSL3_inward.pdb    Alignment file: C6VSL3_inw.pir

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.9% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C6VSL3_outward.pdb    Alignment file: C6VSL3_out.pir

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.6% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C6VSL3_occluded.pdb    Alignment file: C6VSL3_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur