| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C6VSL3
dbSWEET id: dbswt_1662
Accession: C6VSL3
Uniprot status: Unreviewed
Organism: Dyadobacter fermentans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Cytophagia ⇒ Cytophagales ⇒ Cytophagaceae ⇒ Dyadobacter.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: NNNN CVV: 384 CHI: -14
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|C6VSL3|C6VSL3_DYAFD|Unreviewed|Dyadobacter fermentans|89
MDFIEIIGLVAGICTSSAVIPQLVTTIKKKKASQVSTAMFIVLLTGNALWVYYGFEKEDV
PIVATNLFTIGLNIAMLVLKYKYKKRQTE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: C6VSL3_inward.pdb Alignment file: C6VSL3_inw.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 5.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C6VSL3_outward.pdb Alignment file: C6VSL3_out.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 6.6% allowed .7% week .0% disallowed Occluded: Model structure: C6VSL3_occluded.pdb Alignment file: C6VSL3_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA