Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C6TN09

dbSWEET id: dbswt_560

Accession:   C6TN09

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   254

Substrate Binding Site:   CNWS           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|C6TN09|C6TN09_SOYBN|Unreviewed|Glycine_max|254
MAETIRLAVAVLGNAASVALYAAPMVTFRRVIRKKSTEEFSCFPYIIGLLNCLLFTWYGL
PVVSYKWENFPLVTVNGVGIVLELSYVLIYFWYASAKGKVKVAMTAIPVLLVLSIIAAVS
AFAFHDNHHRKLLVGSIGLGVSVTMYGSPLIVMKKVIQTKSVEFMPLPLSMCSFLATVFW
LIYGLFIRDIFVAGPSAVGTPLGILQLVLYCKYRKGSVVEDPSKGDLEKGNLEKVEMEIG
KVEMNVTNHMNGHS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: C6TN09.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C6TN09_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    2.7% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C6TN09_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.4% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C6TN09_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    8.5% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur