Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C6TKW0

dbSWEET id: dbswt_496

Accession:   C6TKW0

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   245

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|C6TKW0|C6TKW0_SOYBN|Unreviewed|Glycine_max|245
MADASFFVGVIGNIISILMFLSPVPTFWKIKKQGSTEDFSSLPYICTLLNCSLWTYYGII
NAREYLVATVNGFGIVVETIYVILFLIYAPKGRRGRTAILAVILDVAILAAAVVITQLAF
QGKARSGAVGVMGAGLNIVMYFSPLSAMKTVVKTKSVEYMPFLLSFFFFLNGGVWLLYAV
LVRDVILGVPNGTGFLLGAMQLVLYAIYRNGKPSSNNRLEEGLQHEPLISQPNKESHQIR
EDRPI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: C6TKW0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C6TKW0_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    3.9% allowed    1.1% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C6TKW0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    5.0% allowed    2.8% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C6TKW0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.0% favored    3.3% allowed    .6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   100776607     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur