Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C6T950

dbSWEET id: dbswt_108

Accession:   C6T950

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   280

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|C6T950|C6T950_SOYBN|Unreviewed|Glycine_max|280
MGSHNALAATFGILGNIISVMVYLAPVPTFYRIYKKKCTDGFHSLPYLLSLMSSMLWLYY
AFLKIHDGVVPLITINSIGCVIELIYILTYIKYAHKDARNLTYTLFAAMNIGFLALVLSS
RFALNGSHRVKVIGWICDAVSLSVFASPLSIMAKVIRTKSVQFMPFYLSFFLTLNAITWF
VYGLSMQDKCIYIPNVGGFALGLVQMVLYGIYRKGSESEKEQGLGEGVINIVVVNPLGPA
EVFPIAVDDNKVKDLVVVDDVTVSQQEKEKNVEAKDDCPV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   214

Alignment file: C6T950.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C6T950_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.7% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C6T950_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C6T950_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.2% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   100800347     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur