Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C5YHQ6
dbSWEET id: dbswt_76
Accession: C5YHQ6
Uniprot status: Unreviewed
Organism: Sorghum bicolor
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.
Sequence Information back to top
Sequence length: 309
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|C5YHQ6|C5YHQ6_SORBI|Unreviewed|Sorghum_bicolor|309
MAGGLFSMAHPAITLSGIAGNIISFLVFLAPVATFLQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVFYLAYAPRKARLRTLAYFFLLDVAAFALV
VVVTLFVVREPHRVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRPAKNNAVLPTTTDGASAVQM
QGQVIELAPNTVAILSVSPIPIVGVHKIEVVEQQHKEAAVAAETRRMAAANPDGAMPEVI
EIVPAVATV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: C5YHQ6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C5YHQ6_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.8% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C5YHQ6_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C5YHQ6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 8060940 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA