Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C5YHQ6

dbSWEET id: dbswt_76

Accession:   C5YHQ6

Uniprot status:   Unreviewed

Organism:   Sorghum bicolor

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.

Sequence Information back to top


Sequence length:   309

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|C5YHQ6|C5YHQ6_SORBI|Unreviewed|Sorghum_bicolor|309
MAGGLFSMAHPAITLSGIAGNIISFLVFLAPVATFLQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVFYLAYAPRKARLRTLAYFFLLDVAAFALV
VVVTLFVVREPHRVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRPAKNNAVLPTTTDGASAVQM
QGQVIELAPNTVAILSVSPIPIVGVHKIEVVEQQHKEAAVAAETRRMAAANPDGAMPEVI
EIVPAVATV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: C5YHQ6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C5YHQ6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.8% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C5YHQ6_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C5YHQ6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   8060940     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0006825 - copper ion transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur